|
Cat. No. |
Batroxobin-99 |
|
Product Overview |
Recombinant Batroxobin Protein,
produced in yeast, is a single, glycosilated polypeptide chain
containing 213 amino acids and having a 28-33 kDa. |
|
Description |
Batroxobin is a
serin protease that reduces fibronogen levels and is originally
extracted from snake venom of Bothrops Atrox. Batroxobin is used in
defibrinogenation and thrombolysis and also has an effect on c-fos
gene and growth factor. Batroxobin can efficiently restrain
proliferation of VSMCs, by blocking the release and uptake of Ca2+,
thus influencing [Ca2+]i. Batroxobin is a single chain glycopeptide
with a molecular mass of 43kDa on SDS-PAGE gel and its pI-6.6.
Batroxobin converts fibrinogen to fibrin through the restricted
release of fibrinopeptide-A from fibrinogen to promote blood to
clot. Unlike thrombin, it is not affected by heparin and hirudin. |
|
Synonyms |
Thrombin-like
enzyme batroxobin, EC 3.4.21.74, BX, Bothrops atrox serine
proteinase, Venombin-A, Defibrase, Reptilase, Batroxobin. |
|
Source |
Pichia Pastoris |
|
Amino Acid Sequence |
VIGGDECDINEHPFLAFMYYSPRYFCGMTLINQEWVLTAAHCNRRFMRIHLGKHAGSVANYDE
VVRYPKEKFICPNKKKNVITDKDIMLIRLDRPVKNSEHIAPLSLPSN
PPSVGSVCRIMGWGAITTSEDTYPDVPHCANINLFNNTVCREAYNGLPAKTLCAGVLQGGIDT
CGGDSGGPLICNGQFQGILSWGSDPCAEPRKPAFYTKVFDYLPWIQ S IIAGNKTATC P. |
|
Physical Appearance |
Sterile Filtered
liquid formulation. |
|
Purity |
Greater than 97.0%
as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
|
Formulation |
The Batroxobin
protein solution contains 20mM sodium acetate buffer, pH 7.4. |
|
Solubility |
It is recommended
to reconstitute the lyophilized Antigen-85B in sterile 18MΩ-cm H2O
not less than 100µg/ml, which can then be further diluted to other
aqueous solutions. |
|
Biological Activity |
Batroxobin’s
biological activity was found to be of no less than 500KU/mg. (Klobusitzky
Unit). |
|
Storage |
Batroxobin although stable at 15℃
for 2 weeks,
should be stored desiccated below -18℃.
For long term storage it is recommended to add a carrier protein
(0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
|
|
Download Datasheet:
|
|
