|
Cat. No. |
ADIPOQ-490H |
|
Product
Overview |
Recombinant
Human adiponectin, C1Q and collagen domain containing encoding
the human Adiponectin protein sequence (containing the signal
peptide sequence, and the mature Adiponectin sequence) was
expressed in modified human 293 cells. |
|
Description |
Adiponectin is a member of the
‘adipocytokines’ that are cytokines that are expressed from
adipose tissues. Its general functions include regulation of
energy homeostasis, hematopoiesis, inflammation and immunity.
|
|
Source |
Human 293
cells. |
|
Amino Acid
Sequence |
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGP
KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYN
QQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASG
SVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN. |
|
Molecular Mass |
Adiponectin migrates as a broad
band between 25 and 35 kDa in SDS-PAGE due to post-translational
modifications, in particular glycosylation. |
|
pI |
Adiponectin separates into a number
of glycoforms with an observed pI between 4.5 and 8.0 on 2D PAGE
due to post-translational modifications, in particular
glycosylation. |
|
% Carbohydrate |
Purified Adiponectin consists of 0
to 30% carbohydrate by weight. |
|
Glycosylation |
Adiponectin contains O-linked
oligosaccharides. |
|
Purity |
>95%, as determined by SDS-PAGE and
visualized by Coomassie Brilliant Blue. |
|
Formulation |
When reconstituted in 0.5 ml
sterile phosphate-buffered saline, the solution will contain 1%
human serum albumin (HSA) and 10% trehalose. |
|
Reconstitution |
It is recommended that 0.5 ml of
sterile phosphate-buffered saline be added to the vial. |
|
Storage |
Lyophilized products should be
stored at 2 to 8°C. Following reconstitution short-term storage
at 4°C is recommended, with longer-term storage in aliquots at
-18 to -20°C. Repeated freeze thawing is not recommended. |
|
Activity |
The ED50 of adiponectinB is
typically 3-5 ug/ml as measured by its ability to inhibit M1
cell proliferation. |
|
Gene
Information
|
Gene Name |
ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo
sapiens ] |
|
Synonyms
|
ADIPOQ;
adiponectin, C1Q and collagen domain containing; ACDC; ADPN;
APM1; APM-1; GBP28; ACRP30; ADIPQTL1; adiponectin; APM1 |
|
GeneID |
9370 |
|
mRNA Refseq |
NM_004797 |
|
Protein Refseq |
NP_004788 |
|
UniProt ID |
Q15848 |
|
Chromosome
Location |
3q27 |
|
MIM |
605441 |
|
Pathway |
Adipocytokine
signaling pathway; PPAR signaling pathway; ligand-receptor
interaction; Type II diabetes mellitus |
|
Function |
cytokine
activity; eukaryotic cell surface binding; growth factor
activity; protein homodimerization activity |
|

PDB rendering based on 1c28.
|
Download Datasheet:

|
|