A Division of CD Biosciences, Inc.
Quality recombinant proteins you can count on!

0-9     |    A     |     B     |      C    |     D     |     E     |     F     |     G    |     H    |     I     |    J    |    K    |     L    |    M    |    N    |    O    |    P    |    Q    |    R    |    S    |    T    |    U    |    V    |    W    |    X    |    Y    |    Z

 
Related Products :
 

Instant Quote :

    Your email
   

    Catalog # or name ...
   

    Code:
      

   

    ---------------------------------------------------

Recombinant Proteins :

        Cytokines |

        Chemokines |

        Enzymes |

        Hormones |

        Neurotrophins |

        Ubiquitins |

        Others |

        Kinase |

        Crystallography |

 
    Diagnostic Enzyme

    Diagnostic Antigen

    Diagnostic Antibody

    Pharmaceutical Enzyme

    Crystallography

    Other Products

---------------------------------------------------

  Friend Links :

cGMP Peptide Manufacturer

 

   Others >> NOG(Human)

   Recombinant Human Noggin   [ Back  ]                         Price Inquiry

Cat. No.

CRP21P

Product Overview

Noggin Human Recombinant produced in E.Coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.2 kDa (each chain 23.1 kDa).Noggin is purified by proprietary chromatographic techniques.

Description

Noggin is a polypeptide that inhibits TGF-β signal transduction by binding to TGF-β family ligands and preventing them from binding to their corresponding receptors. Noggin plays a key role in neural induction by inhibiting BMP4, along with other TGF-β signaling inhibitors such as chordin and follistatin. Mouse knockout experiments have demonstrated that noggin also plays a crucial role in bone development, joint formation, and neural tube fusion.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Source

Escherichia Coli.

Amino acid sequence

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGH
YDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPS
EIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDL
GSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQR
RGQRCGWIPIQYPIISECKCSC

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Biological Activity

The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 μg/ml of Noggin.

Formulation

Lyophilized from a 0.2μm filtered solution in 30% CH3CN, 0.1% TFA.

Protein content

Protein quantitation was carried out by two independent methods: UV spectroscopy at 280 nm using the absorbency value of 1.76 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics); Analysis by RP-HPLC, using a standard solution of Noggin as a Reference Standard.

Solubility

It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.

Stability

Lyophilized Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Noggin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

Gene Name

NOG noggin [ Homo sapiens ]

Synonyms

SYM1; SYNS1; NOG; noggin; symphalangism 1 (proximal); synostoses (multiple) syndrome 1

GeneID

9241

mRNA Refseq

NM_005450

Protein Refseq

NP_005441

MIM

602991

UniProt ID

Q13253

Chromosome Location

17q21-q22

Function

cytokine binding; protein homodimerization activity



PDB rendering based on 1m4u. Available structures: 1m4u

 

Download Datasheet:

 
  45-16 Ramsey Road Shirley, NY 11967, USA | Tel: 631-559-9269 Fax: 631-938-8127 | Email:info@creative-biomart.com
  Copyright 2010 (c) Creative Biomart. All rights reserved.